![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | orange1.1g032937m | ||||||||
| Common Name | CISIN_1g032937mg, LOC102609891 | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Sapindales; Rutaceae; Aurantioideae; Citrus
|
||||||||
| Family | SBP | ||||||||
| Protein Properties | Length: 131aa MW: 14726.4 Da PI: 8.4987 | ||||||||
| Description | SBP family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | SBP | 134.5 | 3.4e-42 | 38 | 115 | 1 | 78 |
--SSTT-----TT--HHHHHTT--HHHHT-S-EEETTEEEEE-TTTSSEEETTT--SS--S-STTTT-------S--- CS
SBP 1 lCqvegCeadlseakeyhrrhkvCevhskapvvlvsgleqrfCqqCsrfhelsefDeekrsCrrrLakhnerrrkkqa 78
+C ve+C +dl++a++yhrrhkvCe+hskapvv+v+gl+qrfCqqCsrfhel efDe+krsCrrrLa+hnerrrk++a
orange1.1g032937m 38 CCMVEKCGTDLTDARRYHRRHKVCETHSKAPVVIVAGLRQRFCQQCSRFHELYEFDETKRSCRRRLAGHNERRRKSTA 115
6**************************************************************************976 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| PIRSF | PIRSF037575 | 4.5E-56 | 1 | 125 | IPR017238 | Squamosa promoter-binding protein |
| Gene3D | G3DSA:4.10.1100.10 | 1.4E-34 | 33 | 100 | IPR004333 | Transcription factor, SBP-box |
| PROSITE profile | PS51141 | 32.317 | 36 | 113 | IPR004333 | Transcription factor, SBP-box |
| SuperFamily | SSF103612 | 2.49E-39 | 37 | 117 | IPR004333 | Transcription factor, SBP-box |
| Pfam | PF03110 | 1.8E-32 | 39 | 112 | IPR004333 | Transcription factor, SBP-box |
| Gene Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| GO Term | GO Category | GO Description | ||||
| GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
| GO:0009908 | Biological Process | flower development | ||||
| GO:0010321 | Biological Process | regulation of vegetative phase change | ||||
| GO:0005634 | Cellular Component | nucleus | ||||
| GO:0003677 | Molecular Function | DNA binding | ||||
| GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding | ||||
| GO:0046872 | Molecular Function | metal ion binding | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 131 aa Download sequence Send to blast |
MDNDMEEEEG GVDCYADDER KKKATGRRAA PAGTSSPCCM VEKCGTDLTD ARRYHRRHKV 60 CETHSKAPVV IVAGLRQRFC QQCSRFHELY EFDETKRSCR RRLAGHNERR RKSTAETTGE 120 GSSCRGVGPQ * |
| 3D Structure ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
| 1ul4_A | 2e-34 | 39 | 112 | 11 | 84 | squamosa promoter binding protein-like 4 |
| Search in ModeBase | ||||||
| Expression -- UniGene ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| UniGene ID | E-value | Expressed in | ||||
| Csi.11995 | 0.0 | seed | ||||
| Expression -- Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| Uniprot | TISSUE SPECIFICITY: Ubiquitous. {ECO:0000269|PubMed:16861571}. | |||||
| Functional Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | Probable transcriptional factor. Binds to the promoter of the SQUAMOSA gene. | |||||
| UniProt | Trans-acting factor that binds specifically to the consensus nucleotide sequence 5'-TNCGTACAA-3' (By similarity). May be involved in panicle development. {ECO:0000250}. | |||||
| Binding Motif ? help Back to Top | |||
|---|---|---|---|
| Motif ID | Method | Source | Motif file |
| MP00359 | DAP | Transfer from AT3G15270 | Download |
| |||
| Regulation -- Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | INDUCTION: Negatively regulated by microRNAs miR156b and miR156h. {ECO:0000305|PubMed:16861571}. | |||||
| Regulation -- PlantRegMap ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Upstream Regulator | Target Gene | ||||
| PlantRegMap | Retrieve | Retrieve | ||||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | XP_006451806.1 | 1e-91 | squamosa promoter-binding-like protein 13 | ||||
| Refseq | XP_006464784.1 | 1e-91 | squamosa promoter-binding-like protein 13 | ||||
| Swissprot | Q38740 | 1e-41 | SBP2_ANTMA; Squamosa promoter-binding protein 2 | ||||
| Swissprot | Q6Z461 | 1e-41 | SPL13_ORYSJ; Squamosa promoter-binding-like protein 13 | ||||
| TrEMBL | A0A067FH62 | 3e-90 | A0A067FH62_CITSI; Uncharacterized protein | ||||
| TrEMBL | A0A2H5QHN5 | 3e-90 | A0A2H5QHN5_CITUN; Uncharacterized protein | ||||
| TrEMBL | V4URD2 | 3e-90 | V4URD2_9ROSI; Squamosa promoter-binding protein 1 | ||||
| STRING | XP_006464784.1 | 6e-91 | (Citrus sinensis) | ||||
| STRING | XP_006451806.1 | 6e-91 | (Citrus clementina) | ||||
| Orthologous Group ? help Back to Top | |||
|---|---|---|---|
| Lineage | Orthologous Group ID | Taxa Number | Gene Number |
| Malvids | OGEM868 | 28 | 118 |
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT1G53160.2 | 2e-42 | squamosa promoter binding protein-like 4 | ||||
| Link Out ? help Back to Top | |
|---|---|
| Phytozome | orange1.1g032937m |
| Entrez Gene | 102609891 |
| Publications ? help Back to Top | |||
|---|---|---|---|
|
|||




