![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | orange1.1g034435m | ||||||||
| Common Name | CISIN_1g030647mg | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Sapindales; Rutaceae; Aurantioideae; Citrus
|
||||||||
| Family | NF-YB | ||||||||
| Protein Properties | Length: 96aa MW: 10472 Da PI: 5.0518 | ||||||||
| Description | NF-YB family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | NF-YB | 88.1 | 9.7e-28 | 25 | 73 | 1 | 49 |
NF-YB 1 vreqdrflPianvsrimkkvlPanakiskdaketvqecvsefisfvtse 49
vreqdr+lPian+srimkk+lPan+ki+kdaketvqecvsefisf+tse
orange1.1g034435m 25 VREQDRYLPIANISRIMKKALPANGKIAKDAKETVQECVSEFISFITSE 73
69*********************************************99 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| SuperFamily | SSF47113 | 3.39E-17 | 18 | 73 | IPR009072 | Histone-fold |
| Gene3D | G3DSA:1.10.20.10 | 4.5E-26 | 20 | 73 | IPR009072 | Histone-fold |
| Pfam | PF00808 | 7.1E-17 | 31 | 73 | IPR003958 | Transcription factor CBF/NF-Y/archaeal histone domain |
| Gene Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| GO Term | GO Category | GO Description | ||||
| GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
| GO:0005634 | Cellular Component | nucleus | ||||
| GO:0043565 | Molecular Function | sequence-specific DNA binding | ||||
| GO:0046982 | Molecular Function | protein heterodimerization activity | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 96 aa Download sequence Send to blast |
MAAEAPASPG GGSHESGEQS PRSNVREQDR YLPIANISRI MKKALPANGK IAKDAKETVQ 60 ECVSEFISFI TSEYDVVVLF LFIFVCFFFP SFFCG* |
| 3D Structure ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
| 1n1j_A | 8e-22 | 26 | 73 | 3 | 50 | NF-YB |
| 4awl_B | 8e-22 | 26 | 73 | 4 | 51 | NUCLEAR TRANSCRIPTION FACTOR Y SUBUNIT BETA |
| 4csr_A | 8e-22 | 26 | 73 | 4 | 51 | NUCLEAR TRANSCRIPTION FACTOR Y SUBUNIT BETA |
| Search in ModeBase | ||||||
| Expression -- UniGene ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| UniGene ID | E-value | Expressed in | ||||
| Csi.7878 | 1e-122 | flower | ||||
| Expression -- Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| Uniprot | TISSUE SPECIFICITY: Expressed in flowers and mature rosettes. {ECO:0000269|PubMed:11250072}. | |||||
| Functional Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | Component of the NF-Y/HAP transcription factor complex. The NF-Y complex stimulates the transcription of various genes by recognizing and binding to a CCAAT motif in promoters. | |||||
| Regulation -- PlantRegMap ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Upstream Regulator | Target Gene | ||||
| PlantRegMap | Retrieve | - | ||||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | XP_006428884.1 | 6e-46 | nuclear transcription factor Y subunit B-10 isoform X1 | ||||
| Refseq | XP_006480594.1 | 6e-46 | nuclear transcription factor Y subunit B-10 isoform X2 | ||||
| Refseq | XP_006480596.1 | 5e-46 | nuclear transcription factor Y subunit B-8 isoform X1 | ||||
| Refseq | XP_015386522.1 | 5e-46 | nuclear transcription factor Y subunit B-8 isoform X1 | ||||
| Refseq | XP_024037905.1 | 6e-46 | nuclear transcription factor Y subunit B-10 isoform X1 | ||||
| Refseq | XP_024037906.1 | 5e-46 | nuclear transcription factor Y subunit B-8 isoform X2 | ||||
| Swissprot | Q8VYK4 | 7e-33 | NFYB8_ARATH; Nuclear transcription factor Y subunit B-8 | ||||
| TrEMBL | A0A067EJC8 | 3e-63 | A0A067EJC8_CITSI; Uncharacterized protein | ||||
| STRING | XP_006480596.1 | 2e-45 | (Citrus sinensis) | ||||
| STRING | XP_006428884.1 | 2e-45 | (Citrus clementina) | ||||
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT2G37060.3 | 9e-32 | nuclear factor Y, subunit B8 | ||||
| Link Out ? help Back to Top | |
|---|---|
| Phytozome | orange1.1g034435m |
| Publications ? help Back to Top | |||
|---|---|---|---|
|
|||




