PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Basic Information? help Back to Top

TF ID

orange1.1g036591m

Common Name

CISIN_1g036591mg

Organism

Citrus sinensis

Taxonomic ID

2711

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Sapindales; Rutaceae; Aurantioideae; Citrus

Family

MYB

Protein Properties

Length: 204aa MW: 22976.6 Da PI: 8.8465

Description

MYB family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
orange1.1g036591m	genome	ICGC	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	Myb_DNA-binding	61.5	1.8e-19	11	58	1	48
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 +g+WT+eEd +l+++++ +G+ WktIa++ g++R++k+c++rw +yl orange1.1g036591m 11 KGAWTAEEDRKLAEVIATHGPTKWKTIAAKTGLNRCGKSCRLRWMNYL 58 79********************************************97 PP
2	Myb_DNA-binding	50.1	6.3e-16	64	109	1	48
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 rg+ + +E++l+++++k+lG++ W++Ia +++ gRt++++k++w+++l orange1.1g036591m 64 RGSISDQEEDLILRLHKLLGNR-WSLIAGRLP-GRTDNEIKNYWNSHL 109 788899**************.*****.**********986 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
PROSITE profile	PS51294	18.001	1	58	IPR017930	Myb domain
SMART	SM00717	5.3E-16	10	60	IPR001005	SANT/Myb domain
SuperFamily	SSF46689	2.7E-29	10	105	IPR009057	Homeodomain-like
Pfam	PF00249	3.4E-18	11	58	IPR001005	SANT/Myb domain
Gene3D	G3DSA:1.10.10.60	1.6E-24	12	65	IPR009057	Homeodomain-like
CDD	cd00167	1.99E-11	13	58	No hit	No description
PROSITE profile	PS51294	25.708	59	113	IPR017930	Myb domain
SMART	SM00717	2.6E-15	63	111	IPR001005	SANT/Myb domain
Pfam	PF00249	1.9E-14	64	109	IPR001005	SANT/Myb domain
Gene3D	G3DSA:1.10.10.60	3.6E-25	66	113	IPR009057	Homeodomain-like
CDD	cd00167	2.02E-10	68	109	No hit	No description

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0003677	Molecular Function	DNA binding

Sequence ? help Back to Top
Protein Sequence Length: 204 aa Download sequence Send to blast
MDKSSPATFN KGAWTAEEDR KLAEVIATHG PTKWKTIAAK TGLNRCGKSC RLRWMNYLRP 60 NIKRGSISDQ EEDLILRLHK LLGNRWSLIA GRLPGRTDNE IKNYWNSHLS KKIKNQNEKQ 120 SGVSTSEACR DEKRRATEVI AKAKAVTASE ESKANSIAEE SSNSDNISGN NGFNVDEFFD 180 FSNEDPLNLE WISRFVEPDE GFR*

3D Structure ? help Back to Top

PDB ID	Evalue	Query Start	Query End	Hit Start	Hit End	Description
1h8a_C	4e-30	9	113	25	128	MYB TRANSFORMING PROTEIN
Search in ModeBase

Expression -- Description ? help Back to Top
Source	Description
Uniprot	TISSUE SPECIFICITY: Restricted to roots and hypocotyl. Specifically expressed in root non-hair developing cells (atrichoblasts) at the N position. Also present in lateral root cap cells. In hypocotyls, expressed within files of epidermal cells located outside a single cortical cell equivalent to roots N cells (at protein level). {ECO:0000269\|PubMed:10589676, ECO:0000269\|PubMed:14627722, ECO:0000269\|PubMed:16207757}.

Functional Description ? help Back to Top
Source	Description
UniProt	Transcription activator, when associated with BHLH2/EGL3/MYC146 or BHLH12/MYC1. Involved in epidermal cell fate specification in roots and hypocotyl. Together with GL3 or BHLH2, promotes the formation of non-hair developing cells (atrichoblasts) et the N position in root epidermis. Regulates stomata spatial distribution in hypocotyls. Binds to the WER-binding sites (WBS) promoter regions and activates the transcription of target genes such as GL2 and of CPC. {ECO:0000269\|PubMed:10589676, ECO:0000269\|PubMed:11585796, ECO:0000269\|PubMed:14627722, ECO:0000269\|PubMed:15361138, ECO:0000269\|PubMed:15795220, ECO:0000269\|PubMed:16207757}.

Regulation -- Description ? help Back to Top
Source	Description
UniProt	INDUCTION: Transcriptional activation correlates with reduced histone acetylation on H3 and H4 mediated by HDA18 in N cells. Repressed by CPC in hair cells (H position). {ECO:0000269\|PubMed:11910008, ECO:0000269\|PubMed:16176989}.

Regulation -- PlantRegMap ? help Back to Top
Source	Upstream Regulator	Target Gene
PlantRegMap	Retrieve	-

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_024958001.1	1e-148	transcription factor WER-like
Swissprot	Q9SEI0	3e-54	WER_ARATH; Transcription factor WER
TrEMBL	A0A067FFW3	1e-147	A0A067FFW3_CITSI; Uncharacterized protein
STRING	XP_006426648.1	1e-146	(Citrus clementina)

Orthologous Group ? help Back to Top
Lineage	Orthologous Group ID	Taxa Number	Gene Number
Malvids	OGEM4	28	2646

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT5G14750.1	2e-56	myb domain protein 66

Link Out ? help Back to Top
Phytozome	orange1.1g036591m

Publications ? help Back to Top
Savage N, et al. Positional signaling and expression of ENHANCER OF TRY AND CPC1 are tuned to increase root hair density in response to phosphate deficiency in Arabidopsis thaliana. PLoS ONE, 2013. 8(10): p. e75452 [PMID:24130712] Cheng Y, et al. Brassinosteroids control root epidermal cell fate via direct regulation of a MYB-bHLH-WD40 complex by GSK3-like kinases. Elife, 2018. [PMID:24771765] Kiefer CS, et al. Correction: Arabidopsis AIP1-2 restricted by WER-mediated patterning modulates planar polarity. Development, 2015. 142(5): p. 1022 [PMID:25715402] Kwak SH,Song SK,Lee MM,Schiefelbein J TORNADO1 regulates root epidermal patterning through the WEREWOLF pathway in Arabidopsis thaliana. Plant Signal Behav, 2015. 10(12): p. e1103407 [PMID:26451798] Zhu Y, et al. The Histone Chaperone NRP1 Interacts with WEREWOLF to Activate GLABRA2 in Arabidopsis Root Hair Development. Plant Cell, 2017. 29(2): p. 260-276 [PMID:28138017] Canales J,Contreras-López O,Álvarez JM,Gutiérrez RA Nitrate induction of root hair density is mediated by TGA1/TGA4 and CPC transcription factors in Arabidopsis thaliana. Plant J., 2017. 92(2): p. 305-316 [PMID:28771873] Mira MM, et al. Expression of Arabidopsis class 1 phytoglobin (AtPgb1) delays death and degradation of the root apical meristem during severe PEG-induced water deficit. J. Exp. Bot., 2017. 68(20): p. 5653-5668 [PMID:29059380] Kohanová J, et al. Root hair abundance impacts cadmium accumulation in Arabidopsis thaliana shoots. Ann. Bot., 2018. 122(5): p. 903-914 [PMID:29394308]