![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | orange1.1g037092m | ||||||||
| Common Name | CISIN_1g037092mg | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Sapindales; Rutaceae; Aurantioideae; Citrus
|
||||||||
| Family | MYB_related | ||||||||
| Protein Properties | Length: 77aa MW: 8962.29 Da PI: 10.4697 | ||||||||
| Description | MYB_related family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | Myb_DNA-binding | 28.8 | 2.9e-09 | 8 | 48 | 6 | 48 |
HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
Myb_DNA-binding 6 teEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
eEd l+ ++++ G++ W+ I ++++ gRt+++ +++++ +
orange1.1g037092m 8 DEEDRLICRLFAISGSR-WSVIGAHLP-GRTDNETNNYYRNTK 48
59***************.*********.************975 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| PROSITE profile | PS51294 | 9.403 | 1 | 52 | IPR017930 | Myb domain |
| SMART | SM00717 | 5.7E-5 | 2 | 50 | IPR001005 | SANT/Myb domain |
| SuperFamily | SSF46689 | 1.47E-9 | 5 | 49 | IPR009057 | Homeodomain-like |
| Gene3D | G3DSA:1.10.10.60 | 6.5E-12 | 6 | 46 | IPR009057 | Homeodomain-like |
| CDD | cd00167 | 4.29E-6 | 6 | 48 | No hit | No description |
| Pfam | PF00249 | 1.2E-7 | 8 | 47 | IPR001005 | SANT/Myb domain |
| Gene Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| GO Term | GO Category | GO Description | ||||
| GO:0003677 | Molecular Function | DNA binding | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 77 aa Download sequence Send to blast |
MKPWGFPDEE DRLICRLFAI SGSRWSVIGA HLPGRTDNET NNYYRNTKLK RKHEEGGLKV 60 PMKKNLERDL RIVKNH* |
| Expression -- Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| Uniprot | DEVELOPMENTAL STAGE: Accumulates in an adaxial ball-shaped set of cells in three to five cell layers around the L3 layer of the shoot apical meristem (SAM) in youg plantlets. Later, expressed transiently at the center of the boundary between the SAM and developing leaf primordia. In the inflorescence meristem, confined to the axils of flower primordia. {ECO:0000269|PubMed:16461581, ECO:0000269|PubMed:16473968}. | |||||
| Uniprot | TISSUE SPECIFICITY: Expressed in roots, leaves, internodes, shoot tips and flowers. {ECO:0000269|PubMed:16461581}. | |||||
| Uniprot | TISSUE SPECIFICITY: Mostly expressed in roots. Also present in shoot tips and flower buds. {ECO:0000269|PubMed:16461581}. | |||||
| Functional Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | Transcription activator of genes involved in the regulation of meristematic competence, such as CUC2. Positively regulates axillary meristems (AMs) formation and development, especially at early phases of vegetative growth, probably by specifying a stem cell niche for AM formation. Modulates the negative regulation mediated by gibberellic acid on the timing of developmental phase transitions. {ECO:0000269|PubMed:16461581, ECO:0000269|PubMed:16473968}. | |||||
| UniProt | Transcription factor that functions as regulator of genes affecting cell wall organization and remodeling. Activates genes related to the primary cell wall and represses genes related to the secondary cell wall and expansins. Required for the regulation of longitudinal cell growth in stems, leaves, petioles, roots, flowers and siliques. {ECO:0000269|PubMed:24563287}. | |||||
| Regulation -- Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | INDUCTION: By a shift from short days to long days, in the axils of primordia on the elongating stem. {ECO:0000269|PubMed:16461581}. | |||||
| Regulation -- PlantRegMap ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Upstream Regulator | Target Gene | ||||
| PlantRegMap | Retrieve | - | ||||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | XP_015380805.1 | 4e-32 | transcription factor MYB34-like | ||||
| Swissprot | F4JSU0 | 3e-13 | MYB87_ARATH; Transcription factor MYB87 | ||||
| Swissprot | Q9FG68 | 3e-13 | RAX1_ARATH; Transcription factor RAX1 | ||||
| TrEMBL | A0A067FIH8 | 8e-50 | A0A067FIH8_CITSI; Uncharacterized protein | ||||
| STRING | Pavir.Bb01783.1.p | 6e-15 | (Panicum virgatum) | ||||
| STRING | Traes_5BL_C1D4586B1.2 | 5e-15 | (Triticum aestivum) | ||||
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT5G65790.1 | 9e-16 | myb domain protein 68 | ||||
| Link Out ? help Back to Top | |
|---|---|
| Phytozome | orange1.1g037092m |
| Publications ? help Back to Top | |||
|---|---|---|---|
|
|||




