![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | orange1.1g037152m | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Sapindales; Rutaceae; Aurantioideae; Citrus
|
||||||||
| Family | GATA | ||||||||
| Protein Properties | Length: 76aa MW: 8739.19 Da PI: 10.6613 | ||||||||
| Description | GATA family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | GATA | 60.3 | 2.4e-19 | 10 | 44 | 1 | 35 |
GATA 1 CsnCgttkTplWRrgpdgnktLCnaCGlyyrkkgl 35
Cs+C t +Tp+WR gp g+ktLCnaCG++y++ +l
orange1.1g037152m 10 CSHCETRHTPQWRVGPLGPKTLCNACGVRYKSGRL 44
*******************************9986 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| SMART | SM00401 | 1.3E-13 | 4 | 54 | IPR000679 | Zinc finger, GATA-type |
| SuperFamily | SSF57716 | 3.75E-15 | 7 | 67 | No hit | No description |
| PROSITE profile | PS50114 | 11.372 | 8 | 40 | IPR000679 | Zinc finger, GATA-type |
| Gene3D | G3DSA:3.30.50.10 | 2.2E-15 | 8 | 42 | IPR013088 | Zinc finger, NHR/GATA-type |
| CDD | cd00202 | 4.30E-13 | 9 | 58 | No hit | No description |
| Pfam | PF00320 | 4.4E-17 | 10 | 44 | IPR000679 | Zinc finger, GATA-type |
| Gene Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| GO Term | GO Category | GO Description | ||||
| GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
| GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding | ||||
| GO:0008270 | Molecular Function | zinc ion binding | ||||
| GO:0043565 | Molecular Function | sequence-specific DNA binding | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 76 aa Download sequence Send to blast |
MNEELWQRKC SHCETRHTPQ WRVGPLGPKT LCNACGVRYK SGRLLPEYRP AASPTFDVHI 60 HSNFHRKILK KKKGI* |
| Expression -- Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| Uniprot | TISSUE SPECIFICITY: Mostly expressed in roots. Also expressed in stems, flowers and leaves. {ECO:0000269|PubMed:12139008}. | |||||
| Functional Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | Transcriptional activator that specifically binds 5'-GATA-3' or 5'-GAT-3' motifs within gene promoters. May be involved in the regulation of some light-responsive genes (By similarity). {ECO:0000250}. | |||||
| UniProt | Transcriptional activator that specifically binds 5'-GATA-3' or 5'-GAT-3' motifs within gene promoters. May be involved in the regulation of some light-responsive genes. {ECO:0000269|PubMed:12139008}. | |||||
| Regulation -- Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | INDUCTION: In leaves, less expressed in dark than in light. {ECO:0000269|PubMed:12139008}. | |||||
| Regulation -- PlantRegMap ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Upstream Regulator | Target Gene | ||||
| PlantRegMap | Retrieve | - | ||||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | XP_006432141.1 | 3e-51 | GATA transcription factor 7 | ||||
| Refseq | XP_015384390.1 | 3e-51 | GATA transcription factor 7-like | ||||
| Swissprot | Q8L4M6 | 2e-32 | GATA3_ARATH; GATA transcription factor 3 | ||||
| Swissprot | Q9SV30 | 6e-32 | GATA8_ARATH; GATA transcription factor 8 | ||||
| TrEMBL | V4T746 | 6e-50 | V4T746_9ROSI; Uncharacterized protein | ||||
| STRING | XP_006432141.1 | 1e-50 | (Citrus clementina) | ||||
| Orthologous Group ? help Back to Top | |||
|---|---|---|---|
| Lineage | Orthologous Group ID | Taxa Number | Gene Number |
| Malvids | OGEM5739 | 26 | 47 |
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT4G34680.2 | 1e-34 | GATA transcription factor 3 | ||||
| Link Out ? help Back to Top | |
|---|---|
| Phytozome | orange1.1g037152m |
| Publications ? help Back to Top | |||
|---|---|---|---|
|
|||




