![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | orange1.1g038129m | ||||||||
| Common Name | CISIN_1g038129mg | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Sapindales; Rutaceae; Aurantioideae; Citrus
|
||||||||
| Family | LBD | ||||||||
| Protein Properties | Length: 119aa MW: 13276.3 Da PI: 7.7578 | ||||||||
| Description | LBD family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | DUF260 | 124.2 | 6.8e-39 | 1 | 100 | 1 | 100 |
DUF260 1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleqlka 92
+CaaC++lrr+C++dC++apyfpa++p++fa+vhk++G s+v ++l++lp e r +a+++++ eAe+r++dPvyG+v++i+ lqqq++++++
orange1.1g038129m 1 RCAACRHLRRRCPSDCIFAPYFPANDPHRFACVHKIYGSSKVGNMLQDLPVELRAEAADAICIEAECRVQDPVYGCVRMISLLQQQIHNAES 92
6******************************************************************************************* PP
DUF260 93 elallkee 100
+l+++++e
orange1.1g038129m 93 QLVKARAE 100
***99987 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| Pfam | PF03195 | 2.5E-38 | 1 | 98 | IPR004883 | Lateral organ boundaries, LOB |
| PROSITE profile | PS50891 | 23.329 | 1 | 101 | IPR004883 | Lateral organ boundaries, LOB |
| Gene Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| GO Term | GO Category | GO Description | ||||
| GO:0016020 | Cellular Component | membrane | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 119 aa Download sequence Send to blast |
RCAACRHLRR RCPSDCIFAP YFPANDPHRF ACVHKIYGSS KVGNMLQDLP VELRAEAADA 60 ICIEAECRVQ DPVYGCVRMI SLLQQQIHNA ESQLVKARAE IAVLGSHAQE LRHHVQDI* |
| 3D Structure ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
| 5ly0_A | 9e-33 | 2 | 101 | 12 | 111 | LOB family transfactor Ramosa2.1 |
| 5ly0_B | 9e-33 | 2 | 101 | 12 | 111 | LOB family transfactor Ramosa2.1 |
| Search in ModeBase | ||||||
| Binding Motif ? help Back to Top | |||
|---|---|---|---|
| Motif ID | Method | Source | Motif file |
| MP00381 | DAP | Transfer from AT3G26620 | Download |
| |||
| Regulation -- PlantRegMap ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Upstream Regulator | Target Gene | ||||
| PlantRegMap | Retrieve | Retrieve | ||||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | XP_006490469.1 | 1e-82 | LOB domain-containing protein 23-like | ||||
| Swissprot | P59467 | 6e-47 | LBD23_ARATH; LOB domain-containing protein 23 | ||||
| Swissprot | P59468 | 7e-47 | LBD24_ARATH; LOB domain-containing protein 24 | ||||
| TrEMBL | A0A2H5NM26 | 2e-81 | A0A2H5NM26_CITUN; Uncharacterized protein | ||||
| STRING | XP_006490469.1 | 4e-82 | (Citrus sinensis) | ||||
| Orthologous Group ? help Back to Top | |||
|---|---|---|---|
| Lineage | Orthologous Group ID | Taxa Number | Gene Number |
| Malvids | OGEM131 | 28 | 340 |
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT3G26620.1 | 9e-32 | LOB domain-containing protein 23 | ||||
| Link Out ? help Back to Top | |
|---|---|
| Phytozome | orange1.1g038129m |




