![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | orange1.1g038850m | ||||||||
| Common Name | CISIN_1g038850mg | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Sapindales; Rutaceae; Aurantioideae; Citrus
|
||||||||
| Family | NF-YC | ||||||||
| Protein Properties | Length: 78aa MW: 8921.33 Da PI: 9.1737 | ||||||||
| Description | NF-YC family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | NF-YC | 49.4 | 1e-15 | 6 | 76 | 10 | 80 |
NF-YC 10 iekatdfknhelPlarikkilkadedvkmisaeaPvllskacelfileltlrswlhaeenkrrtlkksdia 80
e++t+ + e+P+ r+kki+k ded++++++ea ++s++ elf+ l+ +s a e+kr+t+k d+
orange1.1g038850m 6 EEQNTETTRPEFPVGRVKKIIKLDEDINKVTSEALFIVSRSTELFLRFLAEKSAEAAIEKKRKTIKLGDMR 76
68999999**********************************************************98876 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| Gene3D | G3DSA:1.10.20.10 | 2.3E-19 | 8 | 76 | IPR009072 | Histone-fold |
| Pfam | PF00808 | 2.5E-18 | 16 | 78 | IPR003958 | Transcription factor CBF/NF-Y/archaeal histone domain |
| SuperFamily | SSF47113 | 3.86E-16 | 17 | 78 | IPR009072 | Histone-fold |
| Gene Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| GO Term | GO Category | GO Description | ||||
| GO:0046982 | Molecular Function | protein heterodimerization activity | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 78 aa Download sequence Send to blast |
MPQEAEEQNT ETTRPEFPVG RVKKIIKLDE DINKVTSEAL FIVSRSTELF LRFLAEKSAE 60 AAIEKKRKTI KLGDMRVA |
| Regulation -- PlantRegMap ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Upstream Regulator | Target Gene | ||||
| PlantRegMap | Retrieve | - | ||||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | XP_006484092.1 | 9e-46 | nuclear transcription factor Y subunit C-4 | ||||
| TrEMBL | A0A067DE78 | 1e-47 | A0A067DE78_CITSI; Uncharacterized protein (Fragment) | ||||
| STRING | XP_006484092.1 | 4e-45 | (Citrus sinensis) | ||||
| Orthologous Group ? help Back to Top | |||
|---|---|---|---|
| Lineage | Orthologous Group ID | Taxa Number | Gene Number |
| Malvids | OGEM12860 | 25 | 30 |
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT5G43250.1 | 2e-20 | nuclear factor Y, subunit C13 | ||||
| Link Out ? help Back to Top | |
|---|---|
| Phytozome | orange1.1g038850m |




