PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Basic Information? help Back to Top

TF ID

orange1.1g042438m

Common Name

CISIN_1g042438mg

Organism

Citrus sinensis

Taxonomic ID

2711

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Sapindales; Rutaceae; Aurantioideae; Citrus

Family

M-type_MADS

Protein Properties

Length: 89aa MW: 10218.8 Da PI: 10.7747

Description

M-type_MADS family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
orange1.1g042438m	genome	ICGC	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	SRF-TF	95.5	2.4e-30	9	59	1	51
S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS SRF-TF 1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51 krienk+nrqvtfskR+ngilKKA+ELSvLCdae+a++ifs++gk y y+s orange1.1g042438m 9 KRIENKTNRQVTFSKRKNGILKKAFELSVLCDAEIALVIFSPSGKAYHYAS 59 79***********************************************86 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
PROSITE profile	PS50066	32.085	1	61	IPR002100	Transcription factor, MADS-box
SMART	SM00432	2.7E-41	1	60	IPR002100	Transcription factor, MADS-box
CDD	cd00265	1.08E-39	2	72	No hit	No description
SuperFamily	SSF55455	3.27E-33	2	76	IPR002100	Transcription factor, MADS-box
PRINTS	PR00404	2.9E-31	3	23	IPR002100	Transcription factor, MADS-box
Pfam	PF00319	2.7E-27	10	57	IPR002100	Transcription factor, MADS-box
PRINTS	PR00404	2.9E-31	23	38	IPR002100	Transcription factor, MADS-box
PRINTS	PR00404	2.9E-31	38	59	IPR002100	Transcription factor, MADS-box

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0006355	Biological Process	regulation of transcription, DNA-templated
GO:0005634	Cellular Component	nucleus
GO:0003677	Molecular Function	DNA binding
GO:0046983	Molecular Function	protein dimerization activity

Sequence ? help Back to Top
Protein Sequence Length: 89 aa Download sequence Send to blast
MGRGKVELKR IENKTNRQVT FSKRKNGILK KAFELSVLCD AEIALVIFSP SGKAYHYASD 60 HHTMDKIIAR YRREVGQLNS ADQRSRLVQ

3D Structure ? help Back to Top

PDB ID	Evalue	Query Start	Query End	Hit Start	Hit End	Description
6byy_A	8e-24	1	71	1	69	MEF2 CHIMERA
6byy_B	8e-24	1	71	1	69	MEF2 CHIMERA
6byy_C	8e-24	1	71	1	69	MEF2 CHIMERA
6byy_D	8e-24	1	71	1	69	MEF2 CHIMERA
6bz1_A	6e-24	1	71	1	69	MEF2 CHIMERA
6bz1_B	6e-24	1	71	1	69	MEF2 CHIMERA
6bz1_C	6e-24	1	71	1	69	MEF2 CHIMERA
6bz1_D	6e-24	1	71	1	69	MEF2 CHIMERA
Search in ModeBase

Expression -- Description ? help Back to Top
Source	Description
Uniprot	DEVELOPMENTAL STAGE: Expressed in the floral meristem at very early stage of the spikelet (rice flower) development. Expressed in lemmas, paleas and lodicules from early to late stage of flower development. {ECO:0000269\|PubMed:10945340}.

Functional Description ? help Back to Top
Source	Description
UniProt	Probable transcription factor.

Regulation -- PlantRegMap ? help Back to Top
Source	Upstream Regulator	Target Gene
PlantRegMap	Retrieve	-

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_006493218.1	2e-60	truncated transcription factor CAULIFLOWER A-like isoform X3
Refseq	XP_024042220.1	2e-60	truncated transcription factor CAULIFLOWER A isoform X1
Refseq	XP_024042221.1	2e-60	truncated transcription factor CAULIFLOWER A isoform X2
Refseq	XP_024949192.1	2e-60	truncated transcription factor CAULIFLOWER A-like isoform X4
Swissprot	Q6Q9I2	7e-32	MAD15_ORYSJ; MADS-box transcription factor 15
TrEMBL	A0A067FE30	2e-59	A0A067FE30_CITSI; Uncharacterized protein (Fragment)
TrEMBL	A0A2H5Q9E7	5e-59	A0A2H5Q9E7_CITUN; Uncharacterized protein
TrEMBL	V4TEQ5	5e-59	V4TEQ5_9ROSI; Uncharacterized protein
STRING	XP_006493217.1	1e-59	(Citrus sinensis)
STRING	XP_006436860.1	8e-60	(Citrus clementina)

Orthologous Group ? help Back to Top
Lineage	Orthologous Group ID	Taxa Number	Gene Number
Malvids	OGEM78	28	413

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT2G03710.3	2e-32	MIKC_MADS family protein

Link Out ? help Back to Top
Phytozome	orange1.1g042438m

Publications ? help Back to Top
Cai Q, et al. [PAEs in composts of municipal sludge and rice straw]. Ying Yong Sheng Tai Xue Bao, 2003. 14(11): p. 1993-6 [PMID:14997664] Wang K, et al. DEP and AFO regulate reproductive habit in rice. PLoS Genet., 2010. 6(1): p. e1000818 [PMID:20107517] Kobayashi K, et al. Inflorescence meristem identity in rice is specified by overlapping functions of three AP1/FUL-like MADS box genes and PAP2, a SEPALLATA MADS box gene. Plant Cell, 2012. 24(5): p. 1848-59 [PMID:22570445] Ramanujam R,Yishi X,Liu H,Naqvi NI Structure-function analysis of Rgs1 in Magnaporthe oryzae: role of DEP domains in subcellular targeting. PLoS ONE, 2012. 7(7): p. e41084 [PMID:22927898] Ang TN,Ngoh GC,Chua AS,Lee MG Elucidation of the effect of ionic liquid pretreatment on rice husk via structural analyses. Biotechnol Biofuels, 2012. 5(1): p. 67 [PMID:22958710] Zhang G,Huang K,Jiang X,Huang D,Yang Y Acetylation of rice straw for thermoplastic applications. Carbohydr Polym, 2013. 96(1): p. 218-26 [PMID:23688473] Wei X, et al. Fine mapping of BH1, a gene controlling lemma and palea development in rice. Plant Cell Rep., 2013. 32(9): p. 1455-63 [PMID:23689259] Hu S, et al. A point mutation in the zinc finger motif of RID1/EHD2/OsID1 protein leads to outstanding yield-related traits in japonica rice variety Wuyunjing 7. Rice (N Y), 2013. 6(1): p. 24 [PMID:24280027] Ji Y, et al. A comprehensive assessment of human exposure to phthalates from environmental media and food in Tianjin, China. J. Hazard. Mater., 2014. 279: p. 133-40 [PMID:25051237] Huang Y, et al. Phthalates in Commercial Chinese Rice Wines: Concentrations and the Cumulative Risk Assessment to Adult Males in Shanghai. Biomed. Environ. Sci., 2014. 27(10): p. 819-23 [PMID:25341819] Tamaki S, et al. FT-like proteins induce transposon silencing in the shoot apex during floral induction in rice. Proc. Natl. Acad. Sci. U.S.A., 2015. 112(8): p. E901-10 [PMID:25675495] Wu F, et al. The ABCs of flower development: mutational analysis of AP1/FUL-like genes in rice provides evidence for a homeotic (A)-function in grasses. Plant J., 2017. 89(2): p. 310-324 [PMID:27689766]