PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Basic Information? help Back to Top

TF ID

orange1.1g045481m

Common Name

CISIN_1g045481mg

Organism

Citrus sinensis

Taxonomic ID

2711

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Sapindales; Rutaceae; Aurantioideae; Citrus

Family

M-type_MADS

Protein Properties

Length: 178aa MW: 20034 Da PI: 8.8843

Description

M-type_MADS family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
orange1.1g045481m	genome	ICGC	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	SRF-TF	67.6	1.2e-21	4	50	3	49
--SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEE CS SRF-TF 3 ienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyey 49 i k n qvtfskRr+g++KKA+ELS+LC++++a+i+fs+ +k + + orange1.1g045481m 4 IPKKNNLQVTFSKRRAGVFKKASELSTLCGVDIALIVFSPANKAFSF 50 7789999**********************************997766 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
PROSITE profile	PS50066	20.927	1	54	IPR002100	Transcription factor, MADS-box
SuperFamily	SSF55455	2.09E-23	1	77	IPR002100	Transcription factor, MADS-box
SMART	SM00432	1.6E-23	1	53	IPR002100	Transcription factor, MADS-box
Pfam	PF00319	1.2E-23	3	50	IPR002100	Transcription factor, MADS-box
PRINTS	PR00404	4.9E-10	16	31	IPR002100	Transcription factor, MADS-box
PRINTS	PR00404	4.9E-10	31	52	IPR002100	Transcription factor, MADS-box

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0006355	Biological Process	regulation of transcription, DNA-templated
GO:0005634	Cellular Component	nucleus
GO:0003677	Molecular Function	DNA binding
GO:0046983	Molecular Function	protein dimerization activity

Sequence ? help Back to Top
Protein Sequence Length: 178 aa Download sequence Send to blast
ISKIPKKNNL QVTFSKRRAG VFKKASELST LCGVDIALIV FSPANKAFSF GHPNVDSILD 60 LYLARNPNPP SESSTDRLIE AHRNANIREL NMQLTQVLHQ LEVEKKHGEV LSEIRKASCR 120 QCWWEAPINE LGLHELEQLK TAMEELKKNV EQQANKILID SKNNPSPFFG LGFWTLS*

3D Structure ? help Back to Top

PDB ID	Evalue	Query Start	Query End	Hit Start	Hit End	Description
3kov_A	4e-15	1	81	7	86	Myocyte-specific enhancer factor 2A
3kov_B	4e-15	1	81	7	86	Myocyte-specific enhancer factor 2A
3kov_I	4e-15	1	81	7	86	Myocyte-specific enhancer factor 2A
3kov_J	4e-15	1	81	7	86	Myocyte-specific enhancer factor 2A
3p57_A	4e-15	1	81	7	86	Myocyte-specific enhancer factor 2A
3p57_B	4e-15	1	81	7	86	Myocyte-specific enhancer factor 2A
3p57_C	4e-15	1	81	7	86	Myocyte-specific enhancer factor 2A
3p57_D	4e-15	1	81	7	86	Myocyte-specific enhancer factor 2A
3p57_I	4e-15	1	81	7	86	Myocyte-specific enhancer factor 2A
3p57_J	4e-15	1	81	7	86	Myocyte-specific enhancer factor 2A
Search in ModeBase

Expression -- Description ? help Back to Top
Source	Description
Uniprot	DEVELOPMENTAL STAGE: Expressed during the syncytial endosperm development. {ECO:0000269\|PubMed:18334668}.
Uniprot	TISSUE SPECIFICITY: Expressed in the endosperm but not in the embryo. Detected in young siliques, roots, leaves, stems, young flowers and anthers. {ECO:0000269\|PubMed:18334668}.

Functional Description ? help Back to Top
Source	Description
UniProt	Probable transcription factor. Required for suppression of cellularization and promotion of nuclear proliferation during early endosperm development. The FERTILIZATION-INDEPENDENT SEED (FIS) polycomb complex is required for suppression of ALG62 expression at the end of the syncytial phase of endosperm development. {ECO:0000269\|PubMed:18334668}.

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_006480851.1	1e-122	agamous-like MADS-box protein AGL62
Swissprot	Q9FKK2	8e-49	AGL62_ARATH; Agamous-like MADS-box protein AGL62
TrEMBL	A0A067D637	1e-127	A0A067D637_CITSI; Uncharacterized protein (Fragment)
STRING	XP_006480851.1	1e-121	(Citrus sinensis)

Orthologous Group ? help Back to Top
Lineage	Orthologous Group ID	Taxa Number	Gene Number
Malvids	OGEM86	28	390

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT5G60440.1	3e-51	AGAMOUS-like 62

Link Out ? help Back to Top
Phytozome	orange1.1g045481m

Publications ? help Back to Top
Xu W, et al. Endosperm and Nucellus Develop Antagonistically in Arabidopsis Seeds. Plant Cell, 2016. 28(6): p. 1343-60 [PMID:27233529] Figueiredo DD,Batista RA,Roszak PJ,Köhler C Auxin production couples endosperm development to fertilization. Nat Plants, 2015. 1: p. 15184 [PMID:27251719] Figueiredo DD,Batista RA,Roszak PJ,Hennig L,Köhler C Auxin production in the endosperm drives seed coat development in Arabidopsis. Elife, 2017. [PMID:27848912] Fiume E,Coen O,Xu W,Lepiniec L,Magnani E Growth of the Arabidopsis sub-epidermal integument cell layers might require an endosperm signal. Plant Signal Behav, 2017. 12(8): p. e1339000 [PMID:28613109] Zhang S, et al. FERTILIZATION-INDEPENDENT SEED-Polycomb Repressive Complex 2 Plays a Dual Role in Regulating Type I MADS-Box Genes in Early Endosperm Development. Plant Physiol., 2018. 177(1): p. 285-299 [PMID:29523711]