PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Basic Information? help Back to Top

TF ID

orange1.1g047530m

Common Name

CISIN_1g047530mg

Organism

Citrus sinensis

Taxonomic ID

2711

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Sapindales; Rutaceae; Aurantioideae; Citrus

Family

LBD

Protein Properties

Length: 72aa MW: 7795.18 Da PI: 10.0758

Description

LBD family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
orange1.1g047530m	genome	ICGC	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	DUF260	68.3	1.7e-21	26	72	1	47
DUF260 1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllk 47 +CaaCk+lrr+C+++Cvlapyfp ++p+kf ++h++FGasn++k+l+ orange1.1g047530m 26 PCAACKILRRRCVEKCVLAPYFPPTEPQKFVIAHRVFGASNIIKFLQ 72 7*******************************************996 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
PROSITE profile	PS50891	17.37	25	72	IPR004883	Lateral organ boundaries, LOB
Pfam	PF03195	1.3E-20	26	72	IPR004883	Lateral organ boundaries, LOB

Sequence ? help Back to Top
Protein Sequence Length: 72 aa Download sequence Send to blast
INASSSQSSP SFAAPQSPPP PVVLSPCAAC KILRRRCVEK CVLAPYFPPT EPQKFVIAHR 60 VFGASNIIKF LQ

3D Structure ? help Back to Top

PDB ID	Evalue	Query Start	Query End	Hit Start	Hit End	Description
5ly0_A	6e-19	17	72	2	57	LOB family transfactor Ramosa2.1
5ly0_B	6e-19	17	72	2	57	LOB family transfactor Ramosa2.1
Search in ModeBase

Expression -- Description ? help Back to Top
Source	Description
Uniprot	TISSUE SPECIFICITY: Expressed in young shoots, roots, stems, leaves and flowers. {ECO:0000269\|PubMed:12068116}.
Uniprot	TISSUE SPECIFICITY: Expressed in young shoots, stems, leaves and flowers. {ECO:0000269\|PubMed:12068116}.

Regulation -- PlantRegMap ? help Back to Top
Source	Upstream Regulator	Target Gene
PlantRegMap	Retrieve	-

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_024956979.1	5e-36	LOB domain-containing protein 1 isoform X1
Swissprot	Q9LQR0	1e-28	LBD1_ARATH; LOB domain-containing protein 1
Swissprot	Q9SK08	2e-28	LBD11_ARATH; LOB domain-containing protein 11
TrEMBL	A0A067E031	9e-43	A0A067E031_CITSI; Uncharacterized protein (Fragment)
STRING	XP_006485928.1	7e-34	(Citrus sinensis)
STRING	XP_006436214.1	2e-34	(Citrus clementina)

Orthologous Group ? help Back to Top
Lineage	Orthologous Group ID	Taxa Number	Gene Number
Malvids	OGEM20654	4	6

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT2G28500.1	3e-24	LOB domain-containing protein 11

Link Out ? help Back to Top
Phytozome	orange1.1g047530m