![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | orange1.1g048610m | ||||||||
| Common Name | CISIN_1g048610mg | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Sapindales; Rutaceae; Aurantioideae; Citrus
|
||||||||
| Family | MYB | ||||||||
| Protein Properties | Length: 87aa MW: 10339.9 Da PI: 10.0739 | ||||||||
| Description | MYB family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | Myb_DNA-binding | 48 | 2.8e-15 | 14 | 61 | 1 | 48 |
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
+g+W +eEd +l+ +++++G +W+ +++ g+ R++k+c++rw +yl
orange1.1g048610m 14 KGSWAPEEDRKLIAYIRRYGIWNWSEMPKYAGLLRCGKSCRLRWMNYL 61
799*****************99**********99************97 PP
| |||||||
| 2 | Myb_DNA-binding | 21.4 | 5.7e-07 | 67 | 87 | 1 | 21 |
TSSS-HHHHHHHHHHHHHTTT CS
Myb_DNA-binding 1 rgrWTteEdellvdavkqlGg 21
rg++T+eEde ++++++qlG+
orange1.1g048610m 67 RGNFTQEEDETIIKLHEQLGN 87
89******************7 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| PROSITE profile | PS51294 | 22.451 | 9 | 65 | IPR017930 | Myb domain |
| Gene3D | G3DSA:1.10.10.60 | 3.1E-20 | 12 | 60 | IPR009057 | Homeodomain-like |
| SMART | SM00717 | 1.1E-10 | 13 | 63 | IPR001005 | SANT/Myb domain |
| Pfam | PF00249 | 1.6E-13 | 14 | 61 | IPR001005 | SANT/Myb domain |
| SuperFamily | SSF46689 | 2.42E-22 | 15 | 87 | IPR009057 | Homeodomain-like |
| CDD | cd00167 | 6.82E-9 | 16 | 61 | No hit | No description |
| Gene3D | G3DSA:1.10.10.60 | 1.5E-10 | 61 | 87 | IPR009057 | Homeodomain-like |
| PROSITE profile | PS51294 | 9.256 | 66 | 87 | IPR017930 | Myb domain |
| Gene Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| GO Term | GO Category | GO Description | ||||
| GO:0003677 | Molecular Function | DNA binding | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 87 aa Download sequence Send to blast |
MVKAPGSEKP SLRKGSWAPE EDRKLIAYIR RYGIWNWSEM PKYAGLLRCG KSCRLRWMNY 60 LRPDIRRGNF TQEEDETIIK LHEQLGN |
| 3D Structure ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
| 1h8a_C | 8e-18 | 10 | 87 | 23 | 99 | MYB TRANSFORMING PROTEIN |
| Search in ModeBase | ||||||
| Functional Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | Transcriptional activator involved in cold stress response (PubMed:14675437, PubMed:20807373, PubMed:22246661). Regulates positively the expression of genes involved in reactive oxygen species (ROS) scavenging such as peroxidase and superoxide dismutase during cold stress. Transactivates a complex gene network that have major effects on stress tolerance and panicle development (PubMed:20807373). {ECO:0000269|PubMed:14675437, ECO:0000269|PubMed:20807373, ECO:0000269|PubMed:22246661}. | |||||
| Regulation -- Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | INDUCTION: By cold stress. {ECO:0000269|PubMed:14675437, ECO:0000269|PubMed:20807373, ECO:0000269|Ref.2}. | |||||
| Regulation -- PlantRegMap ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Upstream Regulator | Target Gene | ||||
| PlantRegMap | Retrieve | - | ||||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | XP_006467925.1 | 1e-58 | myb-related protein 308-like isoform X1 | ||||
| Swissprot | Q7XBH4 | 1e-37 | MYB4_ORYSJ; Transcription factor MYB4 | ||||
| TrEMBL | A0A067GK69 | 6e-58 | A0A067GK69_CITSI; Uncharacterized protein (Fragment) | ||||
| TrEMBL | V4UE25 | 7e-58 | V4UE25_9ROSI; Uncharacterized protein (Fragment) | ||||
| STRING | XP_006467925.1 | 4e-58 | (Citrus sinensis) | ||||
| STRING | XP_006449185.1 | 1e-58 | (Citrus clementina) | ||||
| Orthologous Group ? help Back to Top | |||
|---|---|---|---|
| Lineage | Orthologous Group ID | Taxa Number | Gene Number |
| Malvids | OGEM4 | 28 | 2646 |
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT2G31180.1 | 5e-39 | myb domain protein 14 | ||||
| Link Out ? help Back to Top | |
|---|---|
| Phytozome | orange1.1g048610m |
| Publications ? help Back to Top | |||
|---|---|---|---|
|
|||




