PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID snap_masked-scaffold00193-abinit-gene-0.31-mRNA-1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fagales; Fagaceae; Castanea
Family MYB
Protein Properties Length: 173aa    MW: 19642.6 Da    PI: 9.9423
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
snap_masked-scaffold00193-abinit-gene-0.31-mRNA-1genomeTHGPView Nucleic Acid
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding59.38.3e-19956148
                                                       TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
                                    Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                                                       +g WT+eEd +l d+++ +G+g W++Ia++ g++R++k+c++rw +yl
  snap_masked-scaffold00193-abinit-gene-0.31-mRNA-1  9 KGLWTEEEDRILMDYIRVHGKGKWNRIAKMAGLKRCGKSCRLRWINYL 56
                                                       678*******************************************97 PP

2Myb_DNA-binding57.43.3e-1862107148
                                                        TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
                                    Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                                                        rg +++eE++l+++++++ G++ W++Ia +++ gRt++q+k++w+++l
  snap_masked-scaffold00193-abinit-gene-0.31-mRNA-1  62 RGDFSEEEEDLIIRLHNLIGNR-WSLIAGRVP-GRTDNQVKNHWNTHL 107
                                                        899*******************.*********.************996 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129419.178456IPR017930Myb domain
SuperFamilySSF466892.16E-317103IPR009057Homeodomain-like
SMARTSM007175.1E-15858IPR001005SANT/Myb domain
PfamPF002493.1E-17956IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.7E-241063IPR009057Homeodomain-like
CDDcd001671.67E-121256No hitNo description
PROSITE profilePS5129427.21557111IPR017930Myb domain
SMARTSM007176.8E-1761109IPR001005SANT/Myb domain
PfamPF002493.5E-1762107IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.604.0E-2664111IPR009057Homeodomain-like
CDDcd001675.68E-1265107No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0048765Biological Processroot hair cell differentiation
GO:0090377Biological Processseed trichome initiation
GO:0090378Biological Processseed trichome elongation
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 173 aa     Download sequence    Send to blast
MEARNEYRKG LWTEEEDRIL MDYIRVHGKG KWNRIAKMAG LKRCGKSCRL RWINYLSPSV  60
KRGDFSEEEE DLIIRLHNLI GNRWSLIAGR VPGRTDNQVK NHWNTHLSKK LGIKKENAKG  120
NASLPSLSRK LGKNTSVPME SNSEPPSDCT CEIGGKTMVE DGSQILCGSL MMI
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A2e-2891117108B-MYB
1h8a_C4e-28611124128MYB TRANSFORMING PROTEIN
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtTranscription activator, when associated with BHLH2/EGL3/MYC146 or BHLH12/MYC1. Involved in epidermal cell fate specification in roots and hypocotyl. Together with GL3 or BHLH2, promotes the formation of non-hair developing cells (atrichoblasts) et the N position in root epidermis. Regulates stomata spatial distribution in hypocotyls. Binds to the WER-binding sites (WBS) promoter regions and activates the transcription of target genes such as GL2 and of CPC. {ECO:0000269|PubMed:10589676, ECO:0000269|PubMed:11585796, ECO:0000269|PubMed:14627722, ECO:0000269|PubMed:15361138, ECO:0000269|PubMed:15795220, ECO:0000269|PubMed:16207757}.
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: Transcriptional activation correlates with reduced histone acetylation on H3 and H4 mediated by HDA18 in N cells. Repressed by CPC in hair cells (H position). {ECO:0000269|PubMed:11910008, ECO:0000269|PubMed:16176989}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_023907643.11e-107transcription factor WER-like
SwissprotQ9SEI03e-67WER_ARATH; Transcription factor WER
TrEMBLA0A2N9IZX75e-97A0A2N9IZX7_FAGSY; Uncharacterized protein
STRINGVIT_17s0000g08480.t015e-78(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF3134817
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G14750.11e-69myb domain protein 66
Publications ? help Back to Top
  1. Savage N, et al.
    Positional signaling and expression of ENHANCER OF TRY AND CPC1 are tuned to increase root hair density in response to phosphate deficiency in Arabidopsis thaliana.
    PLoS ONE, 2013. 8(10): p. e75452
    [PMID:24130712]
  2. Cheng Y, et al.
    Brassinosteroids control root epidermal cell fate via direct regulation of a MYB-bHLH-WD40 complex by GSK3-like kinases.
    Elife, 2018.
    [PMID:24771765]
  3. Kiefer CS, et al.
    Correction: Arabidopsis AIP1-2 restricted by WER-mediated patterning modulates planar polarity.
    Development, 2015. 142(5): p. 1022
    [PMID:25715402]
  4. Kwak SH,Song SK,Lee MM,Schiefelbein J
    TORNADO1 regulates root epidermal patterning through the WEREWOLF pathway in Arabidopsis thaliana.
    Plant Signal Behav, 2015. 10(12): p. e1103407
    [PMID:26451798]
  5. Zhu Y, et al.
    The Histone Chaperone NRP1 Interacts with WEREWOLF to Activate GLABRA2 in Arabidopsis Root Hair Development.
    Plant Cell, 2017. 29(2): p. 260-276
    [PMID:28138017]
  6. Canales J,Contreras-López O,Álvarez JM,Gutiérrez RA
    Nitrate induction of root hair density is mediated by TGA1/TGA4 and CPC transcription factors in Arabidopsis thaliana.
    Plant J., 2017. 92(2): p. 305-316
    [PMID:28771873]
  7. Mira MM, et al.
    Expression of Arabidopsis class 1 phytoglobin (AtPgb1) delays death and degradation of the root apical meristem during severe PEG-induced water deficit.
    J. Exp. Bot., 2017. 68(20): p. 5653-5668
    [PMID:29059380]
  8. Kohanová J, et al.
    Root hair abundance impacts cadmium accumulation in Arabidopsis thaliana shoots.
    Ann. Bot., 2018. 122(5): p. 903-914
    [PMID:29394308]