 |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | snap_masked-scaffold08253-abinit-gene-0.10-mRNA-1 | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fagales; Fagaceae; Castanea
|
||||||||
| Family | NAC | ||||||||
| Protein Properties | Length: 129aa MW: 14548.8 Da PI: 10.0376 | ||||||||
| Description | NAC family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | NAM | 36.5 | 1.4e-11 | 11 | 53 | 1 | 44 |
NAM 1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykveP 44
lppGfrF+P+deel+v+yL++kv++++l++ ++ ++ +++++ P
snap_masked-scaffold08253-abinit-gene-0.10-mRNA-1 11 LPPGFRFRPSDEELIVHYLQNKVTSRPLPA-TIPEKSEVLEWRP 53
79*************************998.5455557776665 PP
| |||||||
| 2 | NAM | 58.5 | 2.3e-18 | 50 | 108 | 71 | 128 |
NAM 71 gkrknratksgyWkatgkdkevlsk.kgelvglkktLvfykgrapkgektdWvmheyrl 128
+ r+nrat+sgyWka+g+dk++l++ ++e +g+kk Lvfy+gr pk++ktd +m+eyrl
snap_masked-scaffold08253-abinit-gene-0.10-mRNA-1 50 EWRPNRATASGYWKASGTDKPILTScRSECIGVKKALVFYTGRPPKAVKTDKIMDEYRL 108
569********************9988889***************************97 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| PROSITE profile | PS51005 | 19.236 | 1 | 129 | IPR003441 | NAC domain |
| SuperFamily | SSF101941 | 1.96E-30 | 8 | 111 | IPR003441 | NAC domain |
| Pfam | PF02365 | 4.9E-18 | 12 | 108 | IPR003441 | NAC domain |
| Gene Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| GO Term | GO Category | GO Description | ||||
| GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
| GO:0003677 | Molecular Function | DNA binding | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 129 aa Download sequence Send to blast |
MEKKHSSISQ LPPGFRFRPS DEELIVHYLQ NKVTSRPLPA TIPEKSEVLE WRPNRATASG 60 YWKASGTDKP ILTSCRSECI GVKKALVFYT GRPPKAVKTD KIMDEYRLLD MSKPSMLNGS 120 MRVSGYGCQ |
| 3D Structure ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
| 3ulx_A | 4e-27 | 2 | 108 | 6 | 140 | Stress-induced transcription factor NAC1 |
| Search in ModeBase | ||||||
| Functional Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | Transcription activator that binds to, and transactivates the promoter of the abscisic aldehyde oxidase AAO3. Promotes chlorophyll degradation in leaves by enhancing transcription of AAO3, which leads to increased levels of the senescence-inducing hormone abscisic acid (ABA) (PubMed:25516602). Involved in the control of dehydration in senescing leaves. Binds to the DNA sequence 5'-CACGTAAGT-3' of SAG113 promoter. SAG113 acts as negative regulator of ABA signaling for stomatal closure in leaves, and controls water loss during leaf senescence (PubMed:22184656). Transcription factor of the NAC family involved in senescence. May function in the transition between active cell division and cell expansion (PubMed:16640597). Required for normal seed development and morphology (PubMed:18849494). {ECO:0000269|PubMed:16640597, ECO:0000269|PubMed:18849494, ECO:0000269|PubMed:22184656, ECO:0000269|PubMed:25516602}. | |||||
| UniProt | Transcription factor of the NAC family associated with male fertility. Involved in anther development, but not in senescence. Reduced expression of NAC5 via RNAi leads to male-sterility. {ECO:0000269|PubMed:22278768}. | |||||
| Regulation -- Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | INDUCTION: Induced by the heterodimer APETALA3 (AP3)/PISTILLATA (PI) (PubMed:9489703). Induced by senescence (PubMed:22184656, PubMed:24659488, PubMed:25516602). Induced by abscisic acid (ABA) (PubMed:22184656, PubMed:25516602). Induced by ethylene (PubMed:25516602). {ECO:0000269|PubMed:22184656, ECO:0000269|PubMed:24659488, ECO:0000269|PubMed:25516602, ECO:0000269|PubMed:9489703}. | |||||
| UniProt | INDUCTION: Up-regulated by drought, salt and cold treatments. {ECO:0000269|PubMed:18813954}. | |||||
| Regulation -- PlantRegMap ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Upstream Regulator | Target Gene | ||||
| PlantRegMap | Retrieve | - | ||||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | XP_022730122.1 | 2e-47 | NAC transcription factor 32-like | ||||
| Refseq | XP_028757046.1 | 2e-47 | NAC domain-containing protein 2-like | ||||
| Swissprot | O49255 | 3e-37 | NAC29_ARATH; NAC transcription factor 29 | ||||
| Swissprot | Q8H4S4 | 6e-36 | NAC10_ORYSJ; NAC domain-containing protein 10 | ||||
| TrEMBL | A0A2N9HWN8 | 1e-55 | A0A2N9HWN8_FAGSY; Uncharacterized protein | ||||
| STRING | GLYMA12G29360.1 | 5e-45 | (Glycine max) | ||||
| Orthologous Group ? help Back to Top | |||
|---|---|---|---|
| Lineage | Orthologous Group ID | Taxa Number | Gene Number |
| Fabids | OGEF2416 | 29 | 81 |
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT1G69490.1 | 1e-39 | NAC-like, activated by AP3/PI | ||||
| ©2010-2022, Center
for Bioinformatics, Peking University Last Modified: 2022-12-08 Questions or Comments, please contact  |
Supported By
|