![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | snap_masked-scaffold17955-abinit-gene-0.3-mRNA-1 | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fagales; Fagaceae; Castanea
|
||||||||
| Family | MYB_related | ||||||||
| Protein Properties | Length: 62aa MW: 7015.99 Da PI: 7.9741 | ||||||||
| Description | MYB_related family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | Myb_DNA-binding | 31.7 | 3.5e-10 | 14 | 45 | 1 | 32 |
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHT CS
Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmg 32
rg W++eEde+l +++ +G g+W+++++ g
snap_masked-scaffold17955-abinit-gene-0.3-mRNA-1 14 RGLWSPEEDEKLFNYISTYGHGCWTSVPKFAG 45
789*************************9988 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| Gene3D | G3DSA:1.10.10.60 | 5.7E-14 | 6 | 43 | IPR009057 | Homeodomain-like |
| SuperFamily | SSF46689 | 1.31E-9 | 8 | 45 | IPR009057 | Homeodomain-like |
| PROSITE profile | PS51294 | 12.266 | 9 | 62 | IPR017930 | Myb domain |
| Pfam | PF00249 | 1.2E-8 | 14 | 46 | IPR001005 | SANT/Myb domain |
| CDD | cd00167 | 3.30E-7 | 17 | 46 | No hit | No description |
| Gene Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| GO Term | GO Category | GO Description | ||||
| GO:0003677 | Molecular Function | DNA binding | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 62 aa Download sequence Send to blast |
MRHHSCCNKQ NVKRGLWSPE EDEKLFNYIS TYGHGCWTSV PKFAGNIIDH CSPPLSLNAL 60 AI |
| Functional Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | Probable transcription factor that regulates lignified secondary cell wall thickening of the anther endocethium, which is necessary for anther dehiscence (PubMed:12753590, PubMed:17147638, PubMed:17329564). May play a role in specifying early endothecial cell development by regulating a number of genes linked to secondary thickening such as NST1 and NST2. Acts upstream of the lignin biosynthesis pathway (PubMed:17329564). {ECO:0000269|PubMed:12753590, ECO:0000269|PubMed:17147638, ECO:0000269|PubMed:17329564}. | |||||
| Regulation -- Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | INDUCTION: Down-regulated by auxin. {ECO:0000269|PubMed:23410518}. | |||||
| Regulation -- PlantRegMap ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Upstream Regulator | Target Gene | ||||
| PlantRegMap | Retrieve | - | ||||
| Annotation -- Nucleotide ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | |||
| GenBank | KM034655 | 5e-35 | KM034655.1 Jatropha curcas clone JcMYB035 MYB family protein gene, complete cds. | |||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | XP_023526355.1 | 1e-22 | transcription factor MYB26-like isoform X2 | ||||
| Refseq | XP_023526357.1 | 1e-22 | transcription factor MYB26-like isoform X2 | ||||
| Refseq | XP_027927252.1 | 2e-22 | transcription factor MYB26-like isoform X2 | ||||
| Swissprot | Q9SPG3 | 8e-22 | MYB26_ARATH; Transcription factor MYB26 | ||||
| TrEMBL | A0A396GCX3 | 4e-22 | A0A396GCX3_MEDTR; Putative transcription factor MYB-HB-like family | ||||
| STRING | XP_008447615.1 | 9e-22 | (Cucumis melo) | ||||
| STRING | XP_004141218.1 | 8e-22 | (Cucumis sativus) | ||||
| STRING | Lus10015608 | 1e-21 | (Linum usitatissimum) | ||||
| STRING | XP_010087725.1 | 1e-21 | (Morus notabilis) | ||||
| Orthologous Group ? help Back to Top | |||
|---|---|---|---|
| Lineage | Orthologous Group ID | Taxa Number | Gene Number |
| Fabids | OGEF17500 | 4 | 6 |
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT3G13890.2 | 3e-24 | myb domain protein 26 | ||||
| Publications ? help Back to Top | |||
|---|---|---|---|
|
|||




