![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | snap_masked-scaffold21955-abinit-gene-0.0-mRNA-1 | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fagales; Fagaceae; Castanea
|
||||||||
| Family | SRS | ||||||||
| Protein Properties | Length: 91aa MW: 10009.5 Da PI: 11.3323 | ||||||||
| Description | SRS family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | DUF702 | 108.5 | 1.1e-33 | 4 | 81 | 3 | 78 |
DUF702 3 sgtasCqdCGnqakkdCaheRCRtCCksrgfdCathvkstWvpaakrrerqqqlaaasskaaa 65
+g C+dCGn+akkdC+h+RCRtCCk+rgfdC+thv+stWvpaa+rrer+ + +s+
snap_masked-scaffold21955-abinit-gene-0.0-mRNA-1 4 NGMRVCKDCGNRAKKDCSHRRCRTCCKTRGFDCSTHVRSTWVPAARRRERKMLMVGGASTIGG 66
56779*********************************************8776655544443 PP
DUF702 66 sa..aeaaskrkrel 78
+ +++ kr+r++
snap_masked-scaffold21955-abinit-gene-0.0-mRNA-1 67 GSsgSSSGVKRTRSN 81
332355556666654 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| Pfam | PF05142 | 1.7E-30 | 7 | 81 | IPR007818 | Protein of unknown function DUF702 |
| TIGRFAMs | TIGR01623 | 4.8E-26 | 8 | 50 | IPR006510 | Zinc finger, lateral root primordium type 1 |
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 91 aa Download sequence Send to blast |
MVENGMRVCK DCGNRAKKDC SHRRCRTCCK TRGFDCSTHV RSTWVPAARR RERKMLMVGG 60 ASTIGGGSSG SSSGVKRTRS NPKKEFGLLN N |
| Functional Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | Transcription activator that binds DNA on 5'-ACTCTAC-3' and promotes auxin homeostasis-regulating gene expression (e.g. YUC genes), as well as genes affecting stamen development, cell expansion and timing of flowering. Synergistically with other SHI-related proteins, regulates gynoecium, stamen and leaf development in a dose-dependent manner, controlling apical-basal patterning. Promotes style and stigma formation, and influences vascular development during gynoecium development. May also have a role in the formation and/or maintenance of the shoot apical meristem (SAM). {ECO:0000269|PubMed:12361963, ECO:0000269|PubMed:16740145, ECO:0000269|PubMed:16740146, ECO:0000269|PubMed:18811619, ECO:0000269|PubMed:20154152, ECO:0000269|PubMed:22318676}. | |||||
| Regulation -- Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | INDUCTION: Regulated by ESR1 and ESR2. {ECO:0000269|PubMed:21976484}. | |||||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | XP_006470560.1 | 2e-30 | protein LATERAL ROOT PRIMORDIUM 1 | ||||
| Swissprot | Q9SD40 | 4e-24 | SRS1_ARATH; Protein SHI RELATED SEQUENCE 1 | ||||
| TrEMBL | A0A2N9FMN3 | 8e-29 | A0A2N9FMN3_FAGSY; Uncharacterized protein | ||||
| TrEMBL | A0A2N9G8K1 | 6e-29 | A0A2N9G8K1_FAGSY; Uncharacterized protein | ||||
| TrEMBL | V4TGL8 | 7e-29 | V4TGL8_9ROSI; Uncharacterized protein | ||||
| STRING | XP_006470560.1 | 6e-30 | (Citrus sinensis) | ||||
| Orthologous Group ? help Back to Top | |||
|---|---|---|---|
| Lineage | Orthologous Group ID | Taxa Number | Gene Number |
| Fabids | OGEF25300 | 2 | 3 |
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT4G36260.1 | 1e-27 | Lateral root primordium (LRP) protein-related | ||||
| Publications ? help Back to Top | |||
|---|---|---|---|
|
|||




