PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Basic Information? help Back to Top

TF ID

snap_masked-scaffold30561-abinit-gene-0.2-mRNA-1

Organism

Castanea mollissima

Taxonomic ID

60419

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fagales; Fagaceae; Castanea

Family

MYB_related

Protein Properties

Length: 67aa MW: 7500.59 Da PI: 9.3267

Description

MYB_related family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
snap_masked-scaffold30561-abinit-gene-0.2-mRNA-1	genome	THGP	View Nucleic Acid

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	Myb_DNA-binding	34.6	4.4e-11	14	43	1	30
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHH CS Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIart 30 +g+WT+eEd++l+ +++++G ++W++ +++ snap_masked-scaffold30561-abinit-gene-0.2-mRNA-1 14 KGPWTPEEDQKLLAYIEEHGHRSWRALPAK 43 79**********************998765 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
SuperFamily	SSF46689	1.72E-9	8	44	IPR009057	Homeodomain-like
PROSITE profile	PS51294	10.388	9	56	IPR017930	Myb domain
Gene3D	G3DSA:1.10.10.60	1.3E-13	12	44	IPR009057	Homeodomain-like
SMART	SM00717	4.1E-4	13	54	IPR001005	SANT/Myb domain
Pfam	PF00249	1.7E-9	14	43	IPR001005	SANT/Myb domain
CDD	cd00167	1.29E-6	16	50	No hit	No description

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0003677	Molecular Function	DNA binding

Sequence ? help Back to Top
Protein Sequence Length: 67 aa Download sequence Send to blast
MGRSPCCEKV GLKKGPWTPE EDQKLLAYIE EHGHRSWRAL PAKAAKHYNT SKVTNCMGFR 60 DVGKAAD

Functional Description ? help Back to Top
Source	Description
UniProt	Involved in the control of epidermal cell morphogenesis in petals. Promotes unidirectional cell expansion once outgrowth has been initiated (PubMed:17376813). Coordinately with WIN1/SHN1, participates in the regulation of cuticle biosynthesis and wax accumulation in reproductive organs and trichomes. Functions in cuticle nanoridge formation in petals and stamens, and in morphogenesis of petal conical cells and trichomes (PubMed:23709630). Functions as a major regulator of cuticle formation in vegetative organs by regulating the cuticle biosynthesis genes CYP86A8/LCR and CER1 (PubMed:24169067). {ECO:0000269\|PubMed:17376813, ECO:0000269\|PubMed:23709630, ECO:0000269\|PubMed:24169067}.

Regulation -- PlantRegMap ? help Back to Top
Source	Upstream Regulator	Target Gene
PlantRegMap	Retrieve	-

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_018806959.1	3e-24	PREDICTED: myb-related protein Myb4-like
Refseq	XP_020082966.1	9e-24	transcription factor MYB34-like
Refseq	XP_023886483.1	1e-23	transcription factor MYB106-like
Swissprot	Q9LXF1	4e-23	MYB16_ARATH; Transcription factor MYB16
TrEMBL	A0A438H8U1	2e-24	A0A438H8U1_VITVI; Transcription factor MYB106
TrEMBL	B9T6W7	3e-23	B9T6W7_RICCO; R2r3-myb transcription factor, putative
STRING	XP_002533986.1	5e-24	(Ricinus communis)

Orthologous Group ? help Back to Top
Lineage	Orthologous Group ID	Taxa Number	Gene Number
Fabids	OGEF31	34	817

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT5G15310.2	1e-25	myb domain protein 16

Publications ? help Back to Top
Duarte JM, et al. Expression pattern shifts following duplication indicative of subfunctionalization and neofunctionalization in regulatory genes of Arabidopsis. Mol. Biol. Evol., 2006. 23(2): p. 469-78 [PMID:16280546] Ding Y, et al. Four distinct types of dehydration stress memory genes in Arabidopsis thaliana. BMC Plant Biol., 2013. 13: p. 229 [PMID:24377444] Huang BH, et al. Positive selection and functional divergence of R2R3-MYB paralogous genes expressed in inflorescence buds of Scutellaria species (Labiatae). Int J Mol Sci, 2015. 16(3): p. 5900-21 [PMID:25782156] Cui F, et al. Dissecting Abscisic Acid Signaling Pathways Involved in Cuticle Formation. Mol Plant, 2016. 9(6): p. 926-38 [PMID:27060495]